Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALDH8A1 Peptide - middle region

ALDH8A1 Peptide - middle region

Product Specifications

Product Name Alternative

ALDH12, DJ352A20.2

UniProt

Q9H2A2

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001180409.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EEPLFQVEDSSKGQEPNDTNQYLKPPSRPSPDSSESDWETLDPSVLEDPN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GABA B Receptor 1 (GABBR1) Rabbit Polyclonal Antibody
TA360903 100 µL

GABA B Receptor 1 (GABBR1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF488A conjugate, 0.1mg/mL
BNC880253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Laminin (A5), CF488A conjugate, 0.1mg/mL
BNC880308-100 1x 100 µL

Laminin (A5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bloc1s1 (NM_015740) Mouse Tagged ORF Clone
MG200647 10 µg

Bloc1s1 (NM_015740) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Sbk2 Mouse Gene Knockout Kit (CRISPR)
KN515319 1 Kit

Sbk2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MS4A2 (NM_000139) Human Over-expression Lysate
LC400048 20 µg

MS4A2 (NM_000139) Human Over-expression Lysate

Sign In for Pricing
View Details