Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALDH8A1 Peptide - middle region

ALDH8A1 Peptide - middle region

Product Specifications

Product Name Alternative

ALDH12, DJ352A20.2

UniProt

Q9H2A2

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001180409.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EEPLFQVEDSSKGQEPNDTNQYLKPPSRPSPDSSESDWETLDPSVLEDPN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Apc7 (ANAPC7) activation kit by CRISPRa
GA109803 1 Kit

Human Apc7 (ANAPC7) activation kit by CRISPRa

Sign In for Pricing
View Details
Prkcd Rabbit Monoclonal Antibody [Clone ID: 24GB4485]
TA425155 100 µL

Prkcd Rabbit Monoclonal Antibody [Clone ID: 24GB4485]

Sign In for Pricing
View Details
2,5-Diisopropylphenol
TRC-D455390-25MG 25 mg

2,5-Diisopropylphenol

Sign In for Pricing
View Details
Glycitein
TRC-G635400-25MG 25 mg

Glycitein

Sign In for Pricing
View Details
KCTD19 Human Gene Knockout Kit (CRISPR)
KN417497 1 Kit

KCTD19 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PSF1 (GINS1) Human Gene Knockout Kit (CRISPR)
KN403049 1 Kit

PSF1 (GINS1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details