Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AVL9 Peptide - middle region

AVL9 Peptide - middle region

Product Specifications

Product Name Alternative

KIAA0241

UniProt

Q8NBF6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_055875.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DGVTEGLPEEQKKTMADRNLDQLLSNLEDLSNSIQKLHLAENAEPEEQSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ADSS1 Protein
E30P4164 20 µg

Recombinant Human ADSS1 Protein

Sign In for Pricing
View Details
CBLN2, CT (CBLN2, Cerebellin-2) (APC)
MBS6281135-01 0.2 mL

CBLN2, CT (CBLN2, Cerebellin-2) (APC)

Sign In for Pricing
View Details
CBLN2, CT (CBLN2, Cerebellin-2) (APC)
MBS6281135-02 5x 0.2 mL

CBLN2, CT (CBLN2, Cerebellin-2) (APC)

Sign In for Pricing
View Details
Ginkgolide AB
orb320389-01 25 mg

Ginkgolide AB

Sign In for Pricing
View Details
Ginkgolide AB
orb320389-02 50 mg

Ginkgolide AB

Sign In for Pricing
View Details
CLDN19 AAV Vector (Rat) (CMV)
16273106 1 µg

CLDN19 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details