CTPS2 Peptide - middle region
CTPS2 Peptide - middle region
Product Specifications
UniProt
Q9NRF8
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001137474.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GEGPTPDPWGSSDGGVPVSGPSASDPWTPAPAFSDPWGGSPAKPSTNGTT
More Discoveries
Explore Other Products
Browse additional items from our catalog
![PI3 Kinase p110β Antibody [A2M11]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
bs-11250R-Biotin 100 µL
EEA1 Polyclonal Antibody, Biotin Conjugated
Sign In for Pricing
View Details 
LV722359 1.0 µg DNA
DDU Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
Sign In for Pricing
View Details 
K6346508 1.0 µg DNA
Zbtb20 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
Sign In for Pricing
View Details MBS7207483-01 48 Well
Sheep C-type lectin domain family 10 member A (CLEC10A) ELISA Kit
Sign In for Pricing
View Details