CTPS2 Peptide - middle region
CTPS2 Peptide - middle region
Product Specifications
UniProt
Q9NRF8
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001137474.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GEGPTPDPWGSSDGGVPVSGPSASDPWTPAPAFSDPWGGSPAKPSTNGTT
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7016971-01 0.02 mg
Recombinant Kocuria rhizophila Protease HtpX homolog (htpX)
Sign In for Pricing
View Details 
MBS7016971-02 0.1 mg
Recombinant Kocuria rhizophila Protease HtpX homolog (htpX)
Sign In for Pricing
View Details MBS7016971-03 5x 0.1 mg
Recombinant Kocuria rhizophila Protease HtpX homolog (htpX)
Sign In for Pricing
View Details 