Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPN1 Peptide - middle region

EPN1 Peptide - middle region

Product Specifications

UniProt

Q9Y6I3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001123543.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QLPMDYVQRVKRTHSQGGYGSQGYKYNWKLDEARKNLLRTHTTSASARAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Thyroid gland
CB505527 1 Block

Frozen Tissue Blocks, Thyroid gland

Sign In for Pricing
View Details
MMP13 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G5]
TA506689AM 100 µL

MMP13 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G5]

Sign In for Pricing
View Details
Tyrosinase (Melanoma Marker) (rOCA1/812), CF740 conjugate, 0.1mg/mL
BNC742215-500 1x 500 µL

Tyrosinase (Melanoma Marker) (rOCA1/812), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Sec24c Mouse Gene Knockout Kit (CRISPR)
KN515465 1 Kit

Sec24c Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rat FE (Ferritin) ELISA Kit
E-EL-R3018-01 24 Tests

Rat FE (Ferritin) ELISA Kit

Sign In for Pricing
View Details
Rat FE (Ferritin) ELISA Kit
E-EL-R3018-02 48 Tests

Rat FE (Ferritin) ELISA Kit

Sign In for Pricing
View Details