Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GATAD2A Peptide - N-terminal region

GATAD2A Peptide - N-terminal region

Product Specifications

Product Name Alternative

P66alpha

UniProt

Q86YP4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060130.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LGEGREQRPELRKTASSTVWQAQLGEASTRPQAPEEEGNPPESMKPARAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Low Temperature Pumpability & Gelation Index Tester BPTL-201
BPTL-201 1 Unit

Low Temperature Pumpability & Gelation Index Tester BPTL-201

Sign In for Pricing
View Details
Art1 Mouse Gene Knockout Kit (CRISPR)
KN501629 1 Kit

Art1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Follistatin (FST) (NM_006350) Human Recombinant Protein
TP315777 20 µg

Follistatin (FST) (NM_006350) Human Recombinant Protein

Sign In for Pricing
View Details
NKAIN1 (C-term) Rabbit Polyclonal Antibody
AP52882PU-N 400 µL

NKAIN1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Biotin Conjugated Ulex europaeus Lectin (GorseFurze) -UEA-I-
BA-2201-2 2 mg

Biotin Conjugated Ulex europaeus Lectin (GorseFurze) -UEA-I-

Sign In for Pricing
View Details
3-(2-Pyridyldithio)propanoic Acid
TRC-P993030-250MG 250 mg

3-(2-Pyridyldithio)propanoic Acid

Sign In for Pricing
View Details