What is the catalog number for OSBPL1A Peptide - middle region?

The catalog number for OSBPL1A Peptide - middle region is orb1999845.

What sizes are available for OSBPL1A Peptide - middle region?

OSBPL1A Peptide - middle region is available in the following size(s): 100 µg.

Is OSBPL1A Peptide - middle region in stock?

OSBPL1A Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

OSBPL1A Peptide - middle region

Product Specifications

Product Name Alternative

ORP1, ORP-1, OSBPL1B

UniProt

Q9BXW6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001229437.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LYGKWTECLYSVDPATFDAYKKNDKKNTEEKKNSKQMSTSEELDEMPVPD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP2-50477AF405 0.1 mL

Mouse Monoclonal LKAAEAR Motif Containing Protein 1 Antibody (Z36P2C1/E7) [Alexa Fluor 405]

Sign In for Pricing

View Details

MBS037669 Inquire

Chicken Stromelysin-1 ELISA Kit

Sign In for Pricing

View Details

MBS1197261-01 0.05 mg (E-Coli)

Recombinant Yersinia pestis bv. Antiqua Lipoyl synthase (lipA)

Sign In for Pricing

View Details

MBS1197261-02 0.05 mg (Yeast)

Recombinant Yersinia pestis bv. Antiqua Lipoyl synthase (lipA)

Sign In for Pricing

View Details

MBS1197261-03 0.2 mg (E-Coli)

Recombinant Yersinia pestis bv. Antiqua Lipoyl synthase (lipA)

Sign In for Pricing

View Details

MBS1197261-04 0.05 mg (Baculovirus)

Recombinant Yersinia pestis bv. Antiqua Lipoyl synthase (lipA)

Sign In for Pricing

View Details