Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSBPL1A Peptide - middle region

OSBPL1A Peptide - middle region

Product Specifications

Product Name Alternative

ORP1, ORP-1, OSBPL1B

UniProt

Q9BXW6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001229437.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LYGKWTECLYSVDPATFDAYKKNDKKNTEEKKNSKQMSTSEELDEMPVPD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCAM (Melanoma Cell Adhesion Molecule) / MUC18 / CD146 (MCAM/3179), 1mg/mL
BNUM3179-50 1x 50 µL

MCAM (Melanoma Cell Adhesion Molecule) / MUC18 / CD146 (MCAM/3179), 1mg/mL

Sign In for Pricing
View Details
C56D2 Antibody
MBS8587748-01 0.1 mg

C56D2 Antibody

Sign In for Pricing
View Details
C56D2 Antibody
MBS8587748-02 0.1 mL (AF405L)

C56D2 Antibody

Sign In for Pricing
View Details
C56D2 Antibody
MBS8587748-03 0.1 mL (AF405S)

C56D2 Antibody

Sign In for Pricing
View Details
C56D2 Antibody
MBS8587748-04 0.1 mL (AF610)

C56D2 Antibody

Sign In for Pricing
View Details
C56D2 Antibody
MBS8587748-05 0.1 mL (AF635)

C56D2 Antibody

Sign In for Pricing
View Details