Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC25A3 Peptide - C-terminal region

SLC25A3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PHC, PTP, OK/SW-cl.48

UniProt

Q00325

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002626.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GFKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CADM3 Rabbit Polyclonal Antibody
TA364696 100 µL

CADM3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
17-Hydroxy-19-nor-5Alpha,17Alpha-pregn-20-en-3-one
TRC-H948755-10MG 10 mg

17-Hydroxy-19-nor-5Alpha,17Alpha-pregn-20-en-3-one

Sign In for Pricing
View Details
TRP1 (Tyrosinase Related Protein 1) (TA99 + TYRP1/807), CF568 conjugate, 0.1mg/mL
BNC680808-100 1x 100 µL

TRP1 (Tyrosinase Related Protein 1) (TA99 + TYRP1/807), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
cADP-Ribose (cADPR) Ammonium Salt (~90%)
TRC-A291808-1MG 1 mg

cADP-Ribose (cADPR) Ammonium Salt (~90%)

Sign In for Pricing
View Details
KIAA1191 (NM_001079685) Human Recombinant Protein
TP303372 20 µg

KIAA1191 (NM_001079685) Human Recombinant Protein

Sign In for Pricing
View Details
Fura-2, AM Ester, 20x50ug
#50033-1 20x 50 µg

Fura-2, AM Ester, 20x50ug

Sign In for Pricing
View Details