Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC25A3 Peptide - C-terminal region

SLC25A3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PHC, PTP, OK/SW-cl.48

UniProt

Q00325

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002626.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GFKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SLC6A17 activation kit by CRISPRa
GA117987 1 Kit

Human SLC6A17 activation kit by CRISPRa

Sign In for Pricing
View Details
DOPEY2 Rabbit Polyclonal Antibody
0903-3 100 µL

DOPEY2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CEBP Alpha (CEBPA) Rabbit Polyclonal Antibody
AP06373PU-N 100 µg

CEBP Alpha (CEBPA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cyanide Brompheniramine Dimaleate
TRC-B980710-25MG 25 mg

Cyanide Brompheniramine Dimaleate

Sign In for Pricing
View Details
NucView® 530 Caspase-3 Substrate, 1 mM in DMSO
#10406 1x 100 µL

NucView® 530 Caspase-3 Substrate, 1 mM in DMSO

Sign In for Pricing
View Details
Zinviroxime
TRC-Z465300-1MG 1 mg

Zinviroxime

Sign In for Pricing
View Details