Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NEIL1 Peptide - middle region

NEIL1 Peptide - middle region

Product Specifications

Product Name Alternative

FPG1, NEI1, hFPG1

UniProt

Q96FI4

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001243481.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RCYGMPGMSSLQDRHGRTIWFQGDPGPLAPKGRKSRKKKSKATQLSPEDR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ubiquitin (Autophagy Marker) (UBB/1748), CF568 conjugate, 0.1mg/mL
BNC681748-100 1x 100 µL

Ubiquitin (Autophagy Marker) (UBB/1748), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4-(3,4-Dihydro-1,3-dioxo-2(1H)-isoquinolinyl)-benzoic Acid
TRC-D334480-2.5G 2.5 g

4-(3,4-Dihydro-1,3-dioxo-2(1H)-isoquinolinyl)-benzoic Acid

Sign In for Pricing
View Details
OSBP2 Rabbit Polyclonal Antibody
TA361666 100 µL

OSBP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Protein C inhibitor (SERPINA5) (N-term) Rabbit Polyclonal Antibody
AP53858PU-N 400 µL

Protein C inhibitor (SERPINA5) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
7-Chloro-4-oxo-4H-chromene-2-carboxylic Acid
TRC-C375620-10MG 10 mg

7-Chloro-4-oxo-4H-chromene-2-carboxylic Acid

Sign In for Pricing
View Details
CLEC12A CytoSection
TS423798P5 25 Slides

CLEC12A CytoSection

Sign In for Pricing
View Details