Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NEIL1 Peptide - middle region

NEIL1 Peptide - middle region

Product Specifications

Product Name Alternative

FPG1, NEI1, hFPG1

UniProt

Q96FI4

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001243481.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RCYGMPGMSSLQDRHGRTIWFQGDPGPLAPKGRKSRKKKSKATQLSPEDR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (T-Cell Marker) (rC3e/2479), 0.2mg/mL
BNUB3790-500 1x 500 µL

CD3e (T-Cell Marker) (rC3e/2479), 0.2mg/mL

Sign In for Pricing
View Details
Rps19bp1 Mouse Gene Knockout Kit (CRISPR)
KN515088 1 Kit

Rps19bp1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CYPIVF11 (CYP4F11) Mouse Monoclonal Antibody [Clone ID: F21 P6 F5]
AM05375PU-N 200 µg

CYPIVF11 (CYP4F11) Mouse Monoclonal Antibody [Clone ID: F21 P6 F5]

Sign In for Pricing
View Details
Lactulose, >95%
TRC-L165500-5G 5 g

Lactulose, >95%

Sign In for Pricing
View Details
Aniline Hydrochloride
TRC-A662508-1G 1 g

Aniline Hydrochloride

Sign In for Pricing
View Details
DOG-1 (DG1/447 + DOG1.1), CF740 conjugate, 0.1mg/mL
BNC740726-100 1x 100 µL

DOG-1 (DG1/447 + DOG1.1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details