Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL17RB Peptide - middle region

IL17RB Peptide - middle region

Product Specifications

Product Name Alternative

CRL4, EVI27, IL17BR, IL17RH1

UniProt

Q9NRM6

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_061195.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DCIRHKGTVVLCPQTGVPFPLDNNKSKPGGWLPLLLLSLLVATWVLVAGI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNJ18 ORF Vector (Human) (pORF)
ORF022126 1.0 µg DNA

KCNJ18 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
VAMP1 Polyclonal Antibody
MBS9130351-01 0.02 mL

VAMP1 Polyclonal Antibody

Sign In for Pricing
View Details
VAMP1 Polyclonal Antibody
MBS9130351-02 0.1 mL

VAMP1 Polyclonal Antibody

Sign In for Pricing
View Details
VAMP1 Polyclonal Antibody
MBS9130351-03 5x 0.1 mL

VAMP1 Polyclonal Antibody

Sign In for Pricing
View Details
NNMTi
E0133-100mg 100 mg

NNMTi

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Probable phosphoserine aminotransferase (CG11899)
MBS1335155-01 0.02 mg (E-Coli)

Recombinant Drosophila melanogaster Probable phosphoserine aminotransferase (CG11899)

Sign In for Pricing
View Details