IL17RB Peptide - middle region
IL17RB Peptide - middle region
Product Specifications
Product Name Alternative
CRL4, EVI27, IL17BR, IL17RH1
UniProt
Q9NRM6
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_061195.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DCIRHKGTVVLCPQTGVPFPLDNNKSKPGGWLPLLLLSLLVATWVLVAGI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
107000R0-AAT 100 Tests
IFluor® 860 Anti-human CD70 Antibody *Ki-24*
Sign In for Pricing
View Details 
ARP48535_P050-FITC 100 µL
GGPS1 Antibody - C-terminal region : FITC (ARP48535_P050-FITC)
Sign In for Pricing
View Details 
orb911236 100 µL
Phospho-GSK-3 Beta (Ser9) Rabbit Polyclonal Antibody (Cy5)
Sign In for Pricing
View Details