Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYOZ1 Peptide - middle region

MYOZ1 Peptide - middle region

Product Specifications

Product Name Alternative

CS-2, FATZ, MYOZ

UniProt

Q9NP98

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_067068.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HFQKFLPTVGGQLGTAGQGFSYSKSNGRGGSQAGGSGSAGQYGSDQQHHL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBA52 discontinued
515478 100 µg

UBA52 discontinued

Sign In for Pricing
View Details
MEF2C Antibody - middle region : FITC (P100852_P050-FITC)
P100852_P050-FITC 100 µL

MEF2C Antibody - middle region : FITC (P100852_P050-FITC)

Sign In for Pricing
View Details
Julabo Bath Attachment Clamp for Wall Thickness up to 30mm
BAT8164 1 Each

Julabo Bath Attachment Clamp for Wall Thickness up to 30mm

Sign In for Pricing
View Details
General Reverse Triiodothyronine (rT3) ELISA Kit
BSKL62357-01 48 Tests

General Reverse Triiodothyronine (rT3) ELISA Kit

Sign In for Pricing
View Details
General Reverse Triiodothyronine (rT3) ELISA Kit
BSKL62357-02 96 Tests

General Reverse Triiodothyronine (rT3) ELISA Kit

Sign In for Pricing
View Details
Recombinant Chicken Follicle-stimulating hormone receptor (FSHR)
MBS7015203-01 0.02 mg

Recombinant Chicken Follicle-stimulating hormone receptor (FSHR)

Sign In for Pricing
View Details