Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFAF1 Peptide - middle region

NDUFAF1 Peptide - middle region

Product Specifications

Product Name Alternative

CGI65, CIA30, CGI-65

UniProt

Q9Y375

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_057097.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PFLGIRFAEYSSSLQKPVASPGKASSQRKTEGDLQGDHQKEVALDITSSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit TIMP-1 ELISA Kit
ERTT0054 96 Tests

Rabbit TIMP-1 ELISA Kit

Sign In for Pricing
View Details
OKEH06821-96W - GFM1 ELISA Kit (Mouse)
OKEH06821-96W 96 Well

OKEH06821-96W - GFM1 ELISA Kit (Mouse)

Sign In for Pricing
View Details
Recombinant Human EGR1 Protein - (Dry Ice)
H00001958-Q01-25ug 25 µg

Recombinant Human EGR1 Protein - (Dry Ice)

Sign In for Pricing
View Details
Human RPL22L1 shRNA Plasmid
abx966267-01 150 µg

Human RPL22L1 shRNA Plasmid

Sign In for Pricing
View Details
Human RPL22L1 shRNA Plasmid
abx966267-02 300 µg

Human RPL22L1 shRNA Plasmid

Sign In for Pricing
View Details
Chicken CALD ELISA Kit
ECKC0391 96 Tests

Chicken CALD ELISA Kit

Sign In for Pricing
View Details