NDUFAF1 Peptide - middle region
NDUFAF1 Peptide - middle region
Product Specifications
Product Name Alternative
CGI65, CIA30, CGI-65
UniProt
Q9Y375
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_057097.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PFLGIRFAEYSSSLQKPVASPGKASSQRKTEGDLQGDHQKEVALDITSSE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15181534 1 Vial
Lentiviral mouse Mall shRNA (UAS) - Lentiviral mouse Mall shRNA (UAS, GFP) plasmid
Sign In for Pricing
View Details 
MBS072698-01 48 Well
Human Cytochrome b-245 Beta Polypeptide ELISA Kit
Sign In for Pricing
View Details MBS072698-02 96 Well
Human Cytochrome b-245 Beta Polypeptide ELISA Kit
Sign In for Pricing
View Details MBS072698-03 5x 96 Well
Human Cytochrome b-245 Beta Polypeptide ELISA Kit
Sign In for Pricing
View Details MBS072698-04 10x 96 Well
Human Cytochrome b-245 Beta Polypeptide ELISA Kit
Sign In for Pricing
View Details