Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITIH2 Peptide - C-terminal region

ITIH2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

H2P, SHAP

UniProt

P19823

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002207.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NVDFLGIYIPPTNKFSPKAHGLIGQFMQEPKIHIFNERPGKDPEKPEASM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DSC1 Recombinant Protein
OPCD02803-50UG 50 µg

DSC1 Recombinant Protein

Sign In for Pricing
View Details
GNL3L Protein Vector (Mouse) (pPB-N-His)
PV185423 500 ng

GNL3L Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
CD126 Antibody
E38PA5424 100 µL

CD126 Antibody

Sign In for Pricing
View Details
Mouse Tex37 qPCR Primer Pair
QM42846S 200 Tests

Mouse Tex37 qPCR Primer Pair

Sign In for Pricing
View Details
Human ACADS Recombinant Protein
PROTP16219-01 10 µg

Human ACADS Recombinant Protein

Sign In for Pricing
View Details
Human ACADS Recombinant Protein
PROTP16219-02 250 µg

Human ACADS Recombinant Protein

Sign In for Pricing
View Details