ITIH2 Peptide - C-terminal region
ITIH2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
H2P, SHAP
UniProt
P19823
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_002207.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NVDFLGIYIPPTNKFSPKAHGLIGQFMQEPKIHIFNERPGKDPEKPEASM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
bs-1009R-PE-Cy5 100 µL
CXCR1 Polyclonal Antibody, PE-Cy5 Conjugated
Sign In for Pricing
View Details 
MBS1499136-01 0.05 mg
Rabbit anti-human Gastric intrinsic factor polyclonal Antibody(GIF), HRP conjugated
Sign In for Pricing
View Details MBS1499136-02 0.1 mg
Rabbit anti-human Gastric intrinsic factor polyclonal Antibody(GIF), HRP conjugated
Sign In for Pricing
View Details MBS1499136-03 5x 0.1 mg
Rabbit anti-human Gastric intrinsic factor polyclonal Antibody(GIF), HRP conjugated
Sign In for Pricing
View Details SR322674 1 Kit
Synaptogyrin 3 (SYNGR3) Human siRNA Oligo Duplex (Locus ID 9143)
Sign In for Pricing
View Details