Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HECTD3 Peptide - middle region

HECTD3 Peptide - middle region

Product Specifications

UniProt

Q5T447

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_078878.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ACKNAVFTQVYEGLKPSDKYEKPLDYRWPMRYDQWWECKFIAEGIIDQGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UACA / Nucling (UACA/1222), CF405S conjugate, 0.1mg/mL
BNC041222-500 1x 500 µL

UACA / Nucling (UACA/1222), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS520322 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Human FAM111A activation kit by CRISPRa
GA111906 1 Kit

Human FAM111A activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS505313 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
ZAP70 (ZAP70/528 + 2F3.2), CF647 conjugate, 0.1mg/mL
BNC471137-100 1x 100 µL

ZAP70 (ZAP70/528 + 2F3.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
YY1AP1 antibody
FNab09579 100 µg

YY1AP1 antibody

Sign In for Pricing
View Details