Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HECTD3 Peptide - middle region

HECTD3 Peptide - middle region

Product Specifications

UniProt

Q5T447

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_078878.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ACKNAVFTQVYEGLKPSDKYEKPLDYRWPMRYDQWWECKFIAEGIIDQGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Choline kinase alpha (CHKA) (NM_212469) Human Over-expression Lysate
LC403943 20 µg

Choline kinase alpha (CHKA) (NM_212469) Human Over-expression Lysate

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (115D8), 1mg/mL
BNUM0612-50 1x 50 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (115D8), 1mg/mL

Sign In for Pricing
View Details
Tm4sf1 Mouse Gene Knockout Kit (CRISPR)
KN517639 1 Kit

Tm4sf1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Flutazolam
TRC-F599405-50MG 50 mg

Flutazolam

Sign In for Pricing
View Details
Ethyl Imidazole-2-carboxylate
TRC-E919195-5G 5 g

Ethyl Imidazole-2-carboxylate

Sign In for Pricing
View Details
DENND3 Human Gene Knockout Kit (CRISPR)
KN415141 1 Kit

DENND3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details