Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HECTD3 Peptide - middle region

HECTD3 Peptide - middle region

Product Specifications

UniProt

Q5T447

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_078878.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ACKNAVFTQVYEGLKPSDKYEKPLDYRWPMRYDQWWECKFIAEGIIDQGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (T-Cell Marker) (C3e/2858R), CF740 conjugate, 0.1mg/mL
BNC742858-100 1x 100 µL

CD3e (T-Cell Marker) (C3e/2858R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human PACSIN1/Syndapin-1 Protein (His Tag)
PKSH032845-01 10 µg

Recombinant Human PACSIN1/Syndapin-1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human PACSIN1/Syndapin-1 Protein (His Tag)
PKSH032845-02 50 µg

Recombinant Human PACSIN1/Syndapin-1 Protein (His Tag)

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS629433 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
MD1 (LY86) (NM_004271) Human Over-expression Lysate
LC401367 20 µg

MD1 (LY86) (NM_004271) Human Over-expression Lysate

Sign In for Pricing
View Details
Human C6orf226 activation kit by CRISPRa
GA118490 1 Kit

Human C6orf226 activation kit by CRISPRa

Sign In for Pricing
View Details