Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNTB2 Peptide - middle region

SNTB2 Peptide - middle region

Product Specifications

Product Name Alternative

SNT3, SNTL, SNT2B2, EST25263, D16S2531E

UniProt

Q13425

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_006741.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IREVTPYIKKPSLVSDLPWEGAAPQSPSFSGSEDSGSPKHQNSTKDRKII

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASK1 Rabbit mAb
orb1565233-01 20 ul

ASK1 Rabbit mAb

Sign In for Pricing
View Details
ASK1 Rabbit mAb
orb1565233-02 50 µL

ASK1 Rabbit mAb

Sign In for Pricing
View Details
ASK1 Rabbit mAb
orb1565233-03 100 µL

ASK1 Rabbit mAb

Sign In for Pricing
View Details
CDC25C
558012-01 50 µg

CDC25C

Sign In for Pricing
View Details
CDC25C
558012-02 100 µg

CDC25C

Sign In for Pricing
View Details
ADO, CT (ADO, C10orf22, 2-aminoethanethiol dioxygenase, Cysteamine dioxygenase) (MaxLight 750) discontinued
031648-ML750 100 µL

ADO, CT (ADO, C10orf22, 2-aminoethanethiol dioxygenase, Cysteamine dioxygenase) (MaxLight 750) discontinued

Sign In for Pricing
View Details