Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNTB2 Peptide - middle region

SNTB2 Peptide - middle region

Product Specifications

Product Name Alternative

SNT3, SNTL, SNT2B2, EST25263, D16S2531E

UniProt

Q13425

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_006741.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IREVTPYIKKPSLVSDLPWEGAAPQSPSFSGSEDSGSPKHQNSTKDRKII

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Benchtop Low Speed Centrifuge BCBL-201
BCBL-201 1 Unit

Benchtop Low Speed Centrifuge BCBL-201

Sign In for Pricing
View Details
Chromogranin A (CHGA/798), CF488A conjugate, 0.1mg/mL
BNC880798-500 1x 500 µL

Chromogranin A (CHGA/798), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC16 / CA125 (Ovarian Carcinoma Marker) (MUC16/1860), CF488A conjugate, 0.1mg/mL
BNC881860-100 1x 100 µL

MUC16 / CA125 (Ovarian Carcinoma Marker) (MUC16/1860), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD90.2/Thy1.2 Antibody[30H12]
E-AB-F1094G-01 50 Tests

PE/Cyanine5 Anti-Mouse CD90.2/Thy1.2 Antibody[30H12]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD90.2/Thy1.2 Antibody[30H12]
E-AB-F1094G-02 100 Tests

PE/Cyanine5 Anti-Mouse CD90.2/Thy1.2 Antibody[30H12]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD90.2/Thy1.2 Antibody[30H12]
E-AB-F1094G-03 2x 100 Tests

PE/Cyanine5 Anti-Mouse CD90.2/Thy1.2 Antibody[30H12]

Sign In for Pricing
View Details