What is the catalog number for BCL7C Peptide - middle region?

The catalog number for BCL7C Peptide - middle region is orb1999827.

What sizes are available for BCL7C Peptide - middle region?

BCL7C Peptide - middle region is available in the following size(s): 100 µg.

Is BCL7C Peptide - middle region in stock?

BCL7C Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

BCL7C Peptide - middle region

Product Specifications

UniProt

Q8WUZ0

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001273455.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GRGASPRGGGPLILLDLNDENSNQSFHSEGSLQKGTEPSPGGTPQPSRPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VZB77316-01 250 mg

4-Bromo-3-cyclopropyl-1-propyl-1H-pyrazole

Sign In for Pricing

View Details

VZB77316-02 2.5 g

4-Bromo-3-cyclopropyl-1-propyl-1H-pyrazole

Sign In for Pricing

View Details

orb2573947 100 µg

Cathepsin B/CTSB Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing

View Details

LV728354 1.0 µg DNA

HMGN2P43 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing

View Details

A65492-050 50 µL

HTR3D Polyclonal Antibody, FITC Conjugated

Sign In for Pricing

View Details

PV248513 500 ng

ZCCHC10 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing

View Details