Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCL7C Peptide - middle region

BCL7C Peptide - middle region

Product Specifications

UniProt

Q8WUZ0

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001273455.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GRGASPRGGGPLILLDLNDENSNQSFHSEGSLQKGTEPSPGGTPQPSRPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C4orf42 3'UTR GFP Stable Cell Line
TU052320 1.0 mL

C4orf42 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rabbit Anti Human TERF2 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (IHC,ELISA) 200ul
IRBAHUTERF2AP871200UL 200 µL

Rabbit Anti Human TERF2 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (IHC,ELISA) 200ul

Sign In for Pricing
View Details
Tfap2c (Transcription Factor AP-2 gamma, AP2-gamma, AP-22, Activating Enhancer-Binding Protein 2 gamma, Tfap2c, Tcfap2c)
302792 200 µL

Tfap2c (Transcription Factor AP-2 gamma, AP2-gamma, AP-22, Activating Enhancer-Binding Protein 2 gamma, Tfap2c, Tcfap2c)

Sign In for Pricing
View Details
Coro1c ORF Vector (Rat) (pORF)
ORF065325 1.0 µg DNA

Coro1c ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Anti-Apolipoprotein A5 Antibody
MBS8248126-01 0.03 mL

Anti-Apolipoprotein A5 Antibody

Sign In for Pricing
View Details
Anti-Apolipoprotein A5 Antibody
MBS8248126-02 0.05 mL

Anti-Apolipoprotein A5 Antibody

Sign In for Pricing
View Details