Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC134 Peptide - middle region

CCDC134 Peptide - middle region

Product Specifications

UniProt

Q9H6E4

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_079097.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VFNQGPHSPILSLMAQELGISEKDSNFQNPFKIDRTEFIPSTDPFQKALR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KIF12 activation kit by CRISPRa
GA114395 1 Kit

Human KIF12 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Lactate Dehydrogenase A Antibody
RC-6388-01 50 μL

Recombinant Lactate Dehydrogenase A Antibody

Sign In for Pricing
View Details
Recombinant Lactate Dehydrogenase A Antibody
RC-6388-02 100 µL

Recombinant Lactate Dehydrogenase A Antibody

Sign In for Pricing
View Details
Recombinant Lactate Dehydrogenase A Antibody
RC-6388-03 1 mL

Recombinant Lactate Dehydrogenase A Antibody

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIGHM/2558), Biotin conjugate, 0.1mg/mL
BNCB2558-500 1x 500 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIGHM/2558), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ptgs1 Mouse Gene Knockout Kit (CRISPR)
KN514182 1 Kit

Ptgs1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details