Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC134 Peptide - middle region

CCDC134 Peptide - middle region

Product Specifications

UniProt

Q9H6E4

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_079097.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VFNQGPHSPILSLMAQELGISEKDSNFQNPFKIDRTEFIPSTDPFQKALR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant SARS-CoV-2 Spike S1 NTD Protein (ECD, C-His Tag) (Omicron)
PKSV030473 100 µg

Recombinant SARS-CoV-2 Spike S1 NTD Protein (ECD, C-His Tag) (Omicron)

Sign In for Pricing
View Details
GM CSF (CSF2) (NM_000758) Human Recombinant Protein
TP311109 20 µg

GM CSF (CSF2) (NM_000758) Human Recombinant Protein

Sign In for Pricing
View Details
ActinBriteTM 530/555 High Affinity Phalloidin Conjugate, 50 U
#00096-T 1x 50 U

ActinBriteTM 530/555 High Affinity Phalloidin Conjugate, 50 U

Sign In for Pricing
View Details
DUSP26 Polyclonal Antibody
E-AB-11170-01 20 µL

DUSP26 Polyclonal Antibody

Sign In for Pricing
View Details
DUSP26 Polyclonal Antibody
E-AB-11170-02 60 µL

DUSP26 Polyclonal Antibody

Sign In for Pricing
View Details
DUSP26 Polyclonal Antibody
E-AB-11170-03 120 µL

DUSP26 Polyclonal Antibody

Sign In for Pricing
View Details