Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRYZ Peptide - middle region

CRYZ Peptide - middle region

Product Specifications

UniProt

Q08257

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001123514.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAGVIEAVGDNASAFKKGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTEN pSer380/pThr382/383 Rabbit Polyclonal Antibody
AP02355PU-S 50 µL

PTEN pSer380/pThr382/383 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CA5A Rabbit Polyclonal Antibody
TA372154 100 µL

CA5A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human DACT3 activation kit by CRISPRa
GA115636 1 Kit

Human DACT3 activation kit by CRISPRa

Sign In for Pricing
View Details
CLIC4 Recombinant Rabbit Monoclonal Antibody [JE65-09]
HA722058 100 µL

CLIC4 Recombinant Rabbit Monoclonal Antibody [JE65-09]

Sign In for Pricing
View Details
CENPS-CORT (NM_199006) Human Over-expression Lysate
LY433922 100 µg

CENPS-CORT (NM_199006) Human Over-expression Lysate

Sign In for Pricing
View Details
VEGF (Vascular Endothelial Growth Factor) (VG76e), CF594 conjugate, 0.1mg/mL
BNC941687-500 1x 500 µL

VEGF (Vascular Endothelial Growth Factor) (VG76e), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details