Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRYZ Peptide - middle region

CRYZ Peptide - middle region

Product Specifications

UniProt

Q08257

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001123514.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAGVIEAVGDNASAFKKGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cops6 Mouse Gene Knockout Kit (CRISPR)
KN503686 1 Kit

Cops6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Autophagy Antibody Sampler Kit
K2002 1 Kit

Autophagy Antibody Sampler Kit

Sign In for Pricing
View Details
11-Ethoxycarbonyldodecanoic Acid
TRC-E890455-2G 2 g

11-Ethoxycarbonyldodecanoic Acid

Sign In for Pricing
View Details
REA (PHB2) Rabbit Monoclonal Antibody [Clone ID: R01-5J9]
TA384972 100 µL

REA (PHB2) Rabbit Monoclonal Antibody [Clone ID: R01-5J9]

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS803025 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
FBLIM1 (NM_017556) Human Over-expression Lysate
LY402597 100 µg

FBLIM1 (NM_017556) Human Over-expression Lysate

Sign In for Pricing
View Details