Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPS8L2 Peptide - middle region

EPS8L2 Peptide - middle region

Product Specifications

Product Name Alternative

EPS8R2

UniProt

Q9H6S3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_073609.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IEEVSPVSRQSIRNSQKHSPTSEPTPPGDALPPVSSPHTHRGYQPTPAMA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE Anti-Mouse CD122 Antibody[TM-Beta 1]
AN00418D-01 50 Tests

PE Anti-Mouse CD122 Antibody[TM-Beta 1]

Sign In for Pricing
View Details
PE Anti-Mouse CD122 Antibody[TM-Beta 1]
AN00418D-02 100 Tests

PE Anti-Mouse CD122 Antibody[TM-Beta 1]

Sign In for Pricing
View Details
PE Anti-Mouse CD122 Antibody[TM-Beta 1]
AN00418D-03 2x 100 Tests

PE Anti-Mouse CD122 Antibody[TM-Beta 1]

Sign In for Pricing
View Details
VDAC1 / 2 / 3 Recombinant Rabbit monoclonal Antibody
HA723692 100 µL

VDAC1 / 2 / 3 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Topoisomerase I, MT (TOP1MT/488), CF640R conjugate, 0.1mg/mL
BNC400488-500 1x 500 µL

Topoisomerase I, MT (TOP1MT/488), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Horizontal Autoclave BAHZ-801-E
BAHZ-801-E 1 Unit

Horizontal Autoclave BAHZ-801-E

Sign In for Pricing
View Details