Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPS8L2 Peptide - middle region

EPS8L2 Peptide - middle region

Product Specifications

Product Name Alternative

EPS8R2

UniProt

Q9H6S3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_073609.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IEEVSPVSRQSIRNSQKHSPTSEPTPPGDALPPVSSPHTHRGYQPTPAMA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant CDK2 Monoclonal Antibody
E-AB-81426-01 50 µL

Recombinant CDK2 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant CDK2 Monoclonal Antibody
E-AB-81426-02 100 µL

Recombinant CDK2 Monoclonal Antibody

Sign In for Pricing
View Details
Halogen Moisture analyzer BANA-504
BANA-504 1 Unit

Halogen Moisture analyzer BANA-504

Sign In for Pricing
View Details
PAX8 (Renal Cell Marker) (PAX8/2774R), Biotin conjugate, 0.1mg/mL
BNCB2774-100 1x 100 µL

PAX8 (Renal Cell Marker) (PAX8/2774R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ICOS-L / ICOS Ligand / B7RP-1 (Immuno-Oncology Target) (ICOSL/3111), CF568 conjugate, 0.1mg/mL
BNC683111-500 1x 500 µL

ICOS-L / ICOS Ligand / B7RP-1 (Immuno-Oncology Target) (ICOSL/3111), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OTX2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A1]
TA809511BM 100 µL

OTX2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A1]

Sign In for Pricing
View Details