EPS8L3 Peptide - middle region
EPS8L3 Peptide - middle region
Product Specifications
Product Name Alternative
EPS8R3
UniProt
Q8TE67
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_078802.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YQDPVSLRRGSHRLGSTSHFPQEKTHNHDPQPGDPNSRPSSPKPAQPALK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
042038-AP 200 µL
SMC1B, ID (SMC1B, SMC1L2, Structural maintenance of chromosomes protein 1B) (AP) discontinued
Sign In for Pricing
View Details MBS9010785 Inquire
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) At1g66250 Polyclonal Antibody
Sign In for Pricing
View Details 
038727-ML550 100 µL
MYEOV, ID (MYEOV, OCIM, Myeloma-overexpressed gene protein, Oncogene in multiple myeloma) (MaxLight 550) discontinued
Sign In for Pricing
View Details orb3087782 200 µL
Fruit fly Npc2c Rabbit Polyclonal Antibody (Fluoro594)
Sign In for Pricing
View Details orb3088558 200 µL
African malaria mosquito CLIPB4 Rabbit Polyclonal Antibody (Fluoro550)
Sign In for Pricing
View Details 