What is the catalog number for EPS8L3 Peptide - middle region?

The catalog number for EPS8L3 Peptide - middle region is orb1999823.

What sizes are available for EPS8L3 Peptide - middle region?

EPS8L3 Peptide - middle region is available in the following size(s): 100 µg.

Is EPS8L3 Peptide - middle region in stock?

EPS8L3 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

EPS8L3 Peptide - middle region

Product Specifications

Product Name Alternative

EPS8R3

UniProt

Q8TE67

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_078802.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YQDPVSLRRGSHRLGSTSHFPQEKTHNHDPQPGDPNSRPSSPKPAQPALK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSN4B4-500ML 500 mL

ICP Std Tin 10000ug/mL in 3.5% HNO3 - 500ML

Sign In for Pricing

View Details

33R-4356 100 ug

SFRS6 Blocking Peptide

Sign In for Pricing

View Details

orb1461538-01 20 µg

Double Stranded DNA (dsDNA) (Nuclear Marker) Antibody - With BSA and Azide

Sign In for Pricing

View Details

orb1461538-02 100 µg

Double Stranded DNA (dsDNA) (Nuclear Marker) Antibody - With BSA and Azide

Sign In for Pricing

View Details

BT-AP11133-01 20 µL

Mas1 Polyclonal Antibody

Sign In for Pricing

View Details

BT-AP11133-02 50 µL

Mas1 Polyclonal Antibody

Sign In for Pricing

View Details