DLG1 Peptide - middle region
DLG1 Peptide - middle region
Product Specifications
Product Name Alternative
Hdlg, DLGH1, SAP97, SAP-97, dJ1061C18.1.1
UniProt
Q12959
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001091894.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040225-100 1x 100 µL
Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
MBS7251115-01 48 Well
Rabbit BAI1-associated protein 3 (BAIAP3) ELISA Kit
Sign In for Pricing
View Details MBS7251115-02 96 Well
Rabbit BAI1-associated protein 3 (BAIAP3) ELISA Kit
Sign In for Pricing
View Details MBS7251115-03 5x 96 Well
Rabbit BAI1-associated protein 3 (BAIAP3) ELISA Kit
Sign In for Pricing
View Details MBS7251115-04 10x 96 Well
Rabbit BAI1-associated protein 3 (BAIAP3) ELISA Kit
Sign In for Pricing
View Details 