DLG1 Peptide - middle region
DLG1 Peptide - middle region
Product Specifications
Product Name Alternative
Hdlg, DLGH1, SAP97, SAP-97, dJ1061C18.1.1
UniProt
Q12959
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001091894.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS8126152-01 0.1 mg
Monkeypox Virus (MPXV)(Clade Ib) Protein A35R (His Tag)
Sign In for Pricing
View Details MBS8126152-02 5x 0.1 mg
Monkeypox Virus (MPXV)(Clade Ib) Protein A35R (His Tag)
Sign In for Pricing
View Details 
207946-APC 100 µL
ULK2 (Unc-51-like Kinase 2 (C. elegans), OTTHUMP00000065847, Unc-51-like Kinase 2, KIAA0623, Unc51.2) (APC)
Sign In for Pricing
View Details