Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UQCRC2 Peptide - middle region

UQCRC2 Peptide - middle region

Product Specifications

Product Name Alternative

QCR2, UQCR2, MC3DN5

UniProt

P22695

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_003357.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LIGLGVSHPVLKQVAEQFLNMRGGLGLSGAKANYRGGEIREQNGDSLVHA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mini Sample Mouse SELP (P-Selectin) ELISA Kit
E-MSEL-M0029-01 24 Tests

Mini Sample Mouse SELP (P-Selectin) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse SELP (P-Selectin) ELISA Kit
E-MSEL-M0029-02 48 Tests

Mini Sample Mouse SELP (P-Selectin) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse SELP (P-Selectin) ELISA Kit
E-MSEL-M0029-03 96 Tests

Mini Sample Mouse SELP (P-Selectin) ELISA Kit

Sign In for Pricing
View Details
Cyclophilin B (PPIB) (NM_000942) Human Over-expression Lysate
LC424437 20 µg

Cyclophilin B (PPIB) (NM_000942) Human Over-expression Lysate

Sign In for Pricing
View Details
SERPINC1 Mouse Monoclonal Antibody [15F2]
EM1901-10 100 µL

SERPINC1 Mouse Monoclonal Antibody [15F2]

Sign In for Pricing
View Details
ASNA1 Rabbit Polyclonal Antibody
HA500051 100 µL

ASNA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details