PEX26 Peptide - middle region
PEX26 Peptide - middle region
Product Specifications
Product Name Alternative
PBD7A, PBD7B, PEX26M1T, Pex26pM1T
UniProt
Q7Z412
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001121121.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AIHTARQQQKQEHSGSEEAQKPNLEGSVSHKFLSLPMLVRQLWDSAVSHF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7099453 Inquire
Recombinant Mastigocladus laminosus Photosystem II reaction center protein T (psbT), partial
Sign In for Pricing
View Details 131855-ML405 100 µL
Prolactin Receptor (PRLR, PRL-R, PRL Receptor) (MaxLight 405) discontinued
Sign In for Pricing
View Details 
MBS658813-01 0.05 mg
Influenza A, Avian, H5N1, Hemagglutinin (HA) (IN), Control Peptide
Sign In for Pricing
View Details