PEX26 Peptide - middle region
PEX26 Peptide - middle region
Product Specifications
Product Name Alternative
PBD7A, PBD7B, PEX26M1T, Pex26pM1T
UniProt
Q7Z412
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001121121.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AIHTARQQQKQEHSGSEEAQKPNLEGSVSHKFLSLPMLVRQLWDSAVSHF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS8585798-01 0.1 mg
Rabphilin-3A (phospho Ser237) Polyclonal Antibody
Sign In for Pricing
View Details MBS8585798-02 0.1 mL (AF405L)
Rabphilin-3A (phospho Ser237) Polyclonal Antibody
Sign In for Pricing
View Details MBS8585798-03 0.1 mL (AF405S)
Rabphilin-3A (phospho Ser237) Polyclonal Antibody
Sign In for Pricing
View Details MBS8585798-04 0.1 mL (AF610)
Rabphilin-3A (phospho Ser237) Polyclonal Antibody
Sign In for Pricing
View Details MBS8585798-05 0.1 mL (AF635)
Rabphilin-3A (phospho Ser237) Polyclonal Antibody
Sign In for Pricing
View Details MBS8585798-06 0.1 mL (APC)
Rabphilin-3A (phospho Ser237) Polyclonal Antibody
Sign In for Pricing
View Details