Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WIPI2 Peptide - N-terminal region

WIPI2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Atg21, ATG18B, CGI-50, WIPI-2

UniProt

Q9Y4P8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001028690.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LFANFNQDNTEVKGASRAAGLGRRAVVWSLAVGSKSGYKFFSLSSVDKLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Clic5 Mouse Gene Knockout Kit (CRISPR)
KN503462 1 Kit

Clic5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
5-Fluoroorotic Acid Monohydrate (Ultra Pure)
TRC-F595000-5G 5 g

5-Fluoroorotic Acid Monohydrate (Ultra Pure)

Sign In for Pricing
View Details
BAG5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H6]
TA810640BM 100 µL

BAG5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H6]

Sign In for Pricing
View Details
[1,2,4]Triazolo[4,3-a]pyridine-3-thiol
TRC-T796533-10MG 10 mg

[1,2,4]Triazolo[4,3-a]pyridine-3-thiol

Sign In for Pricing
View Details
Mouse Ftmt activation kit by CRISPRa
GA207429 1 Kit

Mouse Ftmt activation kit by CRISPRa

Sign In for Pricing
View Details
CTLA4 Mouse Monoclonal Antibody [Clone ID: OTI1A11]
CF813244 100 µg

CTLA4 Mouse Monoclonal Antibody [Clone ID: OTI1A11]

Sign In for Pricing
View Details