Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHACTR4 Peptide - N-terminal region

PHACTR4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PPP1R124

UniProt

Q8IZ21

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001041648.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VKRGVLLEDPEQGGEDPGKPSDAMLKNGHTTPIGNARSSSPVQVEEEPVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GATA1 pSer142 Rabbit Polyclonal Antibody
AP02341PU-N 100 µL

GATA1 pSer142 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tide Fluor™ 3 phosphoramidite [TF3 CEP] *Superior replacement to Cy3 phosphoramidite*
2274-AAT 100 µmole

Tide Fluor™ 3 phosphoramidite [TF3 CEP] *Superior replacement to Cy3 phosphoramidite*

Sign In for Pricing
View Details
Human DDX19A activation kit by CRISPRa
GA110691 1 Kit

Human DDX19A activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Total RNA, Ovary: right
CR560997 5 µg

Tissue Total RNA, Ovary: right

Sign In for Pricing
View Details
FITC-Rabbit Anti-Mouse IgG
RD90798A-01 120 μL

FITC-Rabbit Anti-Mouse IgG

Sign In for Pricing
View Details
FITC-Rabbit Anti-Mouse IgG
RD90798A-02 500 µL

FITC-Rabbit Anti-Mouse IgG

Sign In for Pricing
View Details