Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHACTR4 Peptide - N-terminal region

PHACTR4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PPP1R124

UniProt

Q8IZ21

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001041648.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VKRGVLLEDPEQGGEDPGKPSDAMLKNGHTTPIGNARSSSPVQVEEEPVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neuritin (NRN1) Rabbit Polyclonal Antibody
TA364528 100 µL

Neuritin (NRN1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SARS-CoV-2 Nucleoprotein Antibody
KC-441-01 50 μL

SARS-CoV-2 Nucleoprotein Antibody

Sign In for Pricing
View Details
SARS-CoV-2 Nucleoprotein Antibody
KC-441-02 100 µL

SARS-CoV-2 Nucleoprotein Antibody

Sign In for Pricing
View Details
SARS-CoV-2 Nucleoprotein Antibody
KC-441-03 1 mL

SARS-CoV-2 Nucleoprotein Antibody

Sign In for Pricing
View Details
Human OR2L5 activation kit by CRISPRa
GA113037 1 Kit

Human OR2L5 activation kit by CRISPRa

Sign In for Pricing
View Details
ACTR1B Rabbit Polyclonal Antibody
TA373235 100 µL

ACTR1B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details