Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPD52L1 Peptide - middle region

TPD52L1 Peptide - middle region

Product Specifications

Product Name Alternative

D53

UniProt

Q16890

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001003395.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MPAMRNSPTFKSFEERVETTVTSLKTKVGGTNPNGGSFEEVLSSTAHASA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Cartilage
CS645035 5x 5 µm

Frozen Tissue Sections, Cartilage

Sign In for Pricing
View Details
SEZ6L (NM_001184773) Human Recombinant Protein
TP330622L 1 mg

SEZ6L (NM_001184773) Human Recombinant Protein

Sign In for Pricing
View Details
VCX2 (NM_016378) Human Recombinant Protein
TP313997M 100 µg

VCX2 (NM_016378) Human Recombinant Protein

Sign In for Pricing
View Details
HRP Conjugated Caragana arborescens Lectin (Pea Tree) -CAA-
H-6701-1 1 mg

HRP Conjugated Caragana arborescens Lectin (Pea Tree) -CAA-

Sign In for Pricing
View Details
Cytokeratin 10/13 (DE-K13), 1mg/mL
BNUM0696-50 1x 50 µL

Cytokeratin 10/13 (DE-K13), 1mg/mL

Sign In for Pricing
View Details
ALDH3A1 (NM_001135168) Human Over-expression Lysate
LY427570 100 µg

ALDH3A1 (NM_001135168) Human Over-expression Lysate

Sign In for Pricing
View Details