Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPD52L1 Peptide - middle region

TPD52L1 Peptide - middle region

Product Specifications

Product Name Alternative

D53

UniProt

Q16890

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001003395.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MPAMRNSPTFKSFEERVETTVTSLKTKVGGTNPNGGSFEEVLSSTAHASA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF454 Mouse Monoclonal Antibody [Clone ID: OTI2G4]
CF810948 100 µg

ZNF454 Mouse Monoclonal Antibody [Clone ID: OTI2G4]

Sign In for Pricing
View Details
Human MIOS activation kit by CRISPRa
GA110119 1 Kit

Human MIOS activation kit by CRISPRa

Sign In for Pricing
View Details
RHOB Human Gene Knockout Kit (CRISPR)
KN209837LP 1 Kit

RHOB Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MTRFR (NM_001143905) Human Over-expression Lysate
LC428398 20 µg

MTRFR (NM_001143905) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Lambda Light Chain (Lamb14), CF640R conjugate, 0.1mg/mL
BNC400860-500 1x 500 µL

Human Lambda Light Chain (Lamb14), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PHD2 Rabbit Polyclonal Antibody
R1510-40 100 µL

PHD2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details