Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ERMAP Peptide - middle region

ERMAP Peptide - middle region

Product Specifications

Product Name Alternative

RD, SC, BTN5, PRO2801

UniProt

Q96PL5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001017922.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NSGWRRARLHFVAVTLDPDTAHPKLILSEDQRCVRLGDRRQPVPDNPQRF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LHX9 Protein Lysate (Human) with C-Ha Tag
26512031 100 µg

LHX9 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
PLEKHG2 Protein Vector (Mouse) (pPB-C-His)
PV217130 500 ng

PLEKHG2 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
FAM206A Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV761295 1.0 µg DNA

FAM206A Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Recombinant Human Cofilin-2 (CFL2)
CSB-EP005281HU-01 20 µg

Recombinant Human Cofilin-2 (CFL2)

Sign In for Pricing
View Details
Recombinant Human Cofilin-2 (CFL2)
CSB-EP005281HU-02 100 µg

Recombinant Human Cofilin-2 (CFL2)

Sign In for Pricing
View Details
Recombinant Human Cofilin-2 (CFL2)
CSB-EP005281HU-03 1 mg

Recombinant Human Cofilin-2 (CFL2)

Sign In for Pricing
View Details