ERMAP Peptide - middle region
ERMAP Peptide - middle region
Product Specifications
Product Name Alternative
RD, SC, BTN5, PRO2801
UniProt
Q96PL5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001017922.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NSGWRRARLHFVAVTLDPDTAHPKLILSEDQRCVRLGDRRQPVPDNPQRF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
28559114 3x 1.0 µg
Mgst3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
Sign In for Pricing
View Details 
MBS6308763-01 0.2 mL
HSPE1, ID (10kD heat shock protein,Heat shock 10kDa protein 1) (FITC)
Sign In for Pricing
View Details MBS6308763-02 5x 0.2 mL
HSPE1, ID (10kD heat shock protein,Heat shock 10kDa protein 1) (FITC)
Sign In for Pricing
View Details MBS6200672-01 0.1 mL
ENTPD5 (Ectonucleoside Triphosphate Diphosphohydrolase 5, NTPDase 5, CD39 Antigen-like 4, ER-UDPase, Guanosine-diphosphatase ENTPD5, GDPase ENTPD5, Nucleoside Diphosphatase, Uridine-diphosphatase ENTPD5, UDPase ENTPD5, CD39L4, PCPH) (MaxLight 490)
Sign In for Pricing
View Details MBS6200672-02 5x 0.1 mL
ENTPD5 (Ectonucleoside Triphosphate Diphosphohydrolase 5, NTPDase 5, CD39 Antigen-like 4, ER-UDPase, Guanosine-diphosphatase ENTPD5, GDPase ENTPD5, Nucleoside Diphosphatase, Uridine-diphosphatase ENTPD5, UDPase ENTPD5, CD39L4, PCPH) (MaxLight 490)
Sign In for Pricing
View Details