Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAFAH2 Peptide - C-terminal region

PAFAH2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HSD-PLA2

UniProt

Q99487

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000428.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GKFFSTETRGSLDPYEGQEVMVRAMLAFLQKHLDLKEDYNQWNNLIEGIG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lung: right upper lobe
CS640611 5x 5 µm

Frozen Tissue Sections, Lung: right upper lobe

Sign In for Pricing
View Details
Porcine ANG1 Antibody Pair Set
E-KAB-0667 50 µL & 100 µg

Porcine ANG1 Antibody Pair Set

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS801576 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
ROS1 Human Gene Knockout Kit (CRISPR)
KN420652 1 Kit

ROS1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Thrombopoietin (THPO) (NM_000460) Human Over-expression Lysate
LC424704 20 µg

Thrombopoietin (THPO) (NM_000460) Human Over-expression Lysate

Sign In for Pricing
View Details
Neomycin Trisulfate Hydrate Deuterated
TRC-N389977-1MG 1 mg

Neomycin Trisulfate Hydrate Deuterated

Sign In for Pricing
View Details