Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLIP1 Peptide - C-terminal region

CLIP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RSN, CLIP, CYLN1, CLIP170, CLIP-170

UniProt

P30622

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001234926.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EMMSEAALNGNGDDLNNYDSDDQEKQSKKKPRLFCDICDCFDLHDTEDCP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HES2 Polyclonal Antibody
UB-GEN-6455 100 µL

HES2 Polyclonal Antibody

Sign In for Pricing
View Details
Human APAF1 / Apoptotic protease-activating factor 1 Recombinant Protein
R1054h 1 Each

Human APAF1 / Apoptotic protease-activating factor 1 Recombinant Protein

Sign In for Pricing
View Details
BRF1, ID (BRF1, BRF, GTF3B, TAF3B2, TAF3C, Transcription factor IIIB 90kD subunit, B-related factor 1, TATA box-binding protein-associated factor, RNA polymerase III, subunit 2) (MaxLight 490)
MBS6278885-01 0.1 mL

BRF1, ID (BRF1, BRF, GTF3B, TAF3B2, TAF3C, Transcription factor IIIB 90kD subunit, B-related factor 1, TATA box-binding protein-associated factor, RNA polymerase III, subunit 2) (MaxLight 490)

Sign In for Pricing
View Details
BRF1, ID (BRF1, BRF, GTF3B, TAF3B2, TAF3C, Transcription factor IIIB 90kD subunit, B-related factor 1, TATA box-binding protein-associated factor, RNA polymerase III, subunit 2) (MaxLight 490)
MBS6278885-02 5x 0.1 mL

BRF1, ID (BRF1, BRF, GTF3B, TAF3B2, TAF3C, Transcription factor IIIB 90kD subunit, B-related factor 1, TATA box-binding protein-associated factor, RNA polymerase III, subunit 2) (MaxLight 490)

Sign In for Pricing
View Details
Digoxin (MaxLight 650) discontinued
D8030-12-ML650 100 µL

Digoxin (MaxLight 650) discontinued

Sign In for Pricing
View Details
Recombinant Mouse Anti-HDAC1 Antibody (clone 1B6A7)
VS3-FY658 Each

Recombinant Mouse Anti-HDAC1 Antibody (clone 1B6A7)

Sign In for Pricing
View Details