Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSBP2 Peptide - middle region

OSBP2 Peptide - middle region

Product Specifications

Product Name Alternative

HLM, ORP4, ORP-4, OSBPL1, OSBPL4

UniProt

Q969R2

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_110385.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MECSKVMHSSPSSPSSDGKQKTVYQTLSAKLLWKKYPLPENAENMYYFSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal DDX39 Antibody
NBP2-98622-100ul 100 µL

Rabbit Polyclonal DDX39 Antibody

Sign In for Pricing
View Details
GPRIN2 Rabbit Polyclonal Antibody (BF350)
orb2385229 100 µL

GPRIN2 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
Human CEP152 qPCR Primer Pair
QH34477S 200 Tests

Human CEP152 qPCR Primer Pair

Sign In for Pricing
View Details
YARS2 Rabbit pAb
A7976 50 µL

YARS2 Rabbit pAb

Sign In for Pricing
View Details
Ece1 siRNA Oligos set (Mouse)
18883174 3x 5 nmol

Ece1 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Rat Monoclonal EPCR Antibody (432714) [mFluor Violet 450 SE]
FAB2749MFV450 0.1 mL

Rat Monoclonal EPCR Antibody (432714) [mFluor Violet 450 SE]

Sign In for Pricing
View Details