Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSBP2 Peptide - middle region

OSBP2 Peptide - middle region

Product Specifications

Product Name Alternative

HLM, ORP4, ORP-4, OSBPL1, OSBPL4

UniProt

Q969R2

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_110385.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MECSKVMHSSPSSPSSDGKQKTVYQTLSAKLLWKKYPLPENAENMYYFSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNNI2 (Troponin I type 2 (skeletal, fast), AMCD2B, DA2B, FSSV, fsTnI, fast-twitch skeletal muscle troponin I, troponin I fast twitch 2, troponin I, fast skeletal muscle, troponin I, fast-twitch isoform, troponin I, fast-twitch skeletal muscle isoform, tro)
167525 100 µg

TNNI2 (Troponin I type 2 (skeletal, fast), AMCD2B, DA2B, FSSV, fsTnI, fast-twitch skeletal muscle troponin I, troponin I fast twitch 2, troponin I, fast skeletal muscle, troponin I, fast-twitch isoform, troponin I, fast-twitch skeletal muscle isoform, tro)

Sign In for Pricing
View Details
Recombinant Human YWHAE Protein
E30P69934A 50 µg

Recombinant Human YWHAE Protein

Sign In for Pricing
View Details
RAB4 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-62966R-BF405-01 20 µL

RAB4 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
RAB4 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-62966R-BF405-02 100 µL

RAB4 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
G-Protein-Coupled Receptor (GPR88, G-Protein-Coupled Receptor GPR88, G-protein coupled receptor 88, gpr88)
G8600-92D 50 µg

G-Protein-Coupled Receptor (GPR88, G-Protein-Coupled Receptor GPR88, G-protein coupled receptor 88, gpr88)

Sign In for Pricing
View Details
Mouse COL2 (Collagen Type II) CLIA Kit
MBS2531440-01 96 Tests

Mouse COL2 (Collagen Type II) CLIA Kit

Sign In for Pricing
View Details